RNF182 anticorps (Middle Region)

N° du produit ABIN635241

Cet anticorps anti-RNF182 est un anticorps Lapin Polyclonal détectant RNF182 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RNF182 anticorps (Middle Region) (ABIN635241)

Antigène: RNF182 (Ring Finger Protein 182 (RNF182))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF182 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF182 anticorps

Épitope: Middle Region

Specificité: RNF182 antibody was raised against the middle region of RNF182

Purification: Affinity purified

Immunogène: RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF182 Blocking Peptide, (ABIN5615900), is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF182

Antigène: RNF182 (Ring Finger Protein 182 (RNF182))

Autre désignation: RNF182

Sujet: RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.

Poids moléculaire: 27 kDa (MW of target protein)